Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated

Product Specifications

Product Name Alternative

Agno

Abbreviation

Recombinant BK polyomavirus Agnoprotein, partial, Biotinylated

UniProt

P14998

Expression Region

1-35aa

Organism

BK polyomavirus (strain AS) (BKPyV)

Target Sequence

MFCEPKNLVVLRQLSRQASVKVGKTWTGTKKRAQR

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Alters the structure of the nuclear envelope by interacting with host CBX5 and disrupting CBX5 association with LBR. Involved in the perinuclear-nuclear localization of the capsid protein VP1 during virion assembly and maturation. Plays an important role in the release of progeny virions from infected cells and in viral propagation, probably by acting as a viral ionic channel in the host plasma membrane. Allows influx of extracellular calcium ions in the host cell. May contribute to viral genome transcription and translation of viral late proteins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCCD1 knockdown cell line
ABC-KD9105 1 Vial

Human MCCD1 knockdown cell line

Sign In for Pricing
View Details
MBNL1 (Muscleblind-like Protein 1, Triplet-expansion RNA-binding Protein, EXP, KIAA0428, MBNL) (MaxLight 550)
129471-ML550 100 µL

MBNL1 (Muscleblind-like Protein 1, Triplet-expansion RNA-binding Protein, EXP, KIAA0428, MBNL) (MaxLight 550)

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody [Clone ID: LBI5A11]
AMM20674VCF 100 µg

CINP Mouse Monoclonal Antibody [Clone ID: LBI5A11]

Sign In for Pricing
View Details
Box of 100 discs of standard filter 73g/m², 150 mm
ST61A0150 Box of 100

Box of 100 discs of standard filter 73g/m², 150 mm

Sign In for Pricing
View Details
Lentiviral human FERMT2 shRNA (UAS) - Lentiviral human FERMT2 shRNA (UAS) (25)
GTR15337616 1 Vial

Lentiviral human FERMT2 shRNA (UAS) - Lentiviral human FERMT2 shRNA (UAS) (25)

Sign In for Pricing
View Details
ERC2 antibody
70R-17131 50 μL

ERC2 antibody

Sign In for Pricing
View Details