Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Small t antigen, Biotinylated

Product Specifications

Product Name Alternative

ST; ST-AG

Abbreviation

Recombinant BK polyomavirus Small t antigen protein, Biotinylated

UniProt

P15000

Expression Region

1-172aa

Organism

BK polyomavirus (strain AS) (BKPyV)

Target Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLKKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWNSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Promotes efficient viral genome replication by accelerating both G1 and S phase progression of the cell cycle. Inhibits host PP2A by binding to the A subunit, thereby displacing lower affinity regulatory B subunit. Inactivation of PP2A in turn results in the transactivation of cyclin A and cyclin D1 promoters. Late during the infection cycle, ST may induce dephosphorylation of host MTOR, leading to the inhibition of cap-dependent translation. May establish and maintain high levels of viral genomes during persistent infection in cell culture.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRX2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
SR314619 2 nmol

MRGPRX2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Sign In for Pricing
View Details
Lentiviral human SLC10A2 shRNA (UAS) - Lentiviral human SLC10A2 shRNA (UAS, GFP) (25)
GTR15121640 1 Vial

Lentiviral human SLC10A2 shRNA (UAS) - Lentiviral human SLC10A2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial
CSB-EP005393HUg2-01 20 µg

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial

Sign In for Pricing
View Details
Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial
CSB-EP005393HUg2-02 100 µg

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial

Sign In for Pricing
View Details
Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial
CSB-EP005393HUg2-03 1 mg

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial

Sign In for Pricing
View Details
Rabbit anti-BATF3 Antibody
MBS4507397-01 0.05 mL

Rabbit anti-BATF3 Antibody

Sign In for Pricing
View Details