Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis LY6/PLAUR domain containing 3 (LYPD3), partial (Active)

Product Specifications

Product Name Alternative

LY6/PLAUR domain containing 3; LYPD3

Abbreviation

Recombinant Cynomolgus monkey LYPD3 protein, partial (Active)

Gene Name

LYPD3

UniProt

A0A7N9CV81

Expression Region

32-293aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

LECYSCVQKADDGCSPHKMKTVKCAPGVDVCTEAVGAVETIHGQFSMGVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYNGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTISVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTSRQGAEH

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

/

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU) . The EC50 is 0.8819-1.688 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.8 kDa

References & Citations

/

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Hairy/Enhancer-Of-Split Related With YRPW Motif Protein 2 (HEY2) ELISA Kit
abx259615 96 Tests

Human Hairy/Enhancer-Of-Split Related With YRPW Motif Protein 2 (HEY2) ELISA Kit

Sign In for Pricing
View Details
Monkey Cytochrome Oxidase 4 ELISA kit
GTR10432330 96 Well

Monkey Cytochrome Oxidase 4 ELISA kit

Sign In for Pricing
View Details
MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (AP) discontinued
248952-AP 100 µL

MSI2 (Musashi Homolog 2 (Drosophila), FLJ36569, MGC3245, MSI2H) (AP) discontinued

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Heart, Auricula (left) (Frozen)
MBS640543-01 5 Sections

Tissue, Section, Human Adult Normal, Heart, Auricula (left) (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Heart, Auricula (left) (Frozen)
MBS640543-02 5x 5 Sections

Tissue, Section, Human Adult Normal, Heart, Auricula (left) (Frozen)

Sign In for Pricing
View Details
BAD (Bcl2 Antagonist of Cell Death, Bcl-2-binding Component 6, Bcl-2-like Protein 8, Bcl2-L-8, Bcl-XL/Bcl-2-associated Death Promoter, BBC6, BCL2L8) (MaxLight 750) discontinued
123798-ML750 100 µL

BAD (Bcl2 Antagonist of Cell Death, Bcl-2-binding Component 6, Bcl-2-like Protein 8, Bcl2-L-8, Bcl-XL/Bcl-2-associated Death Promoter, BBC6, BCL2L8) (MaxLight 750) discontinued

Sign In for Pricing
View Details