Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse General transcription factor II-I (Gtf2i), partial

Product Specifications

Product Name Alternative

GTFII-I; TFII-I; Bruton tyrosine kinase-associated protein 135; BAP-135; BTK-associated protein 135

Abbreviation

Recombinant Mouse Gtf2i protein, partial

Gene Name

Gtf2i

UniProt

Q9ESZ8

Expression Region

730-820aa

Organism

Mus musculus (Mouse)

Target Sequence

ITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Interacts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and PHOX1 and interacts cooperatively with PHOX1 to promote serum-inducible transcription of a reporter gene deriven by the C-FOS serum response element (SRE) . Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box. Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK1 Rabbit Polyclonal Antibody
AP02767PU-S 50 µL

DOK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Propylphosphorothioic Triamide
TRC-P833705-1G 1 g

N-Propylphosphorothioic Triamide

Sign In for Pricing
View Details
DUS2L (DUS2) (NM_017803) Human Over-expression Lysate
LY402618 100 µg

DUS2L (DUS2) (NM_017803) Human Over-expression Lysate

Sign In for Pricing
View Details
TissueScan, Lymphoma cDNA Array II
LYRT102 2 Panels

TissueScan, Lymphoma cDNA Array II

Sign In for Pricing
View Details
Mix-n-StainTM CF®570 Antibody Labeling Kit, 1x (20-50ug) labeling
#92335 1 Kit

Mix-n-StainTM CF®570 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
6-(2,3-Difluorophenyl)picolinic Acid
TRC-D451030-250MG 250 mg

6-(2,3-Difluorophenyl)picolinic Acid

Sign In for Pricing
View Details