Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1) -VLPs

Product Specifications

Product Name Alternative

Membrane-type receptor for bile acids; M-BAR

Abbreviation

Recombinant Mouse Gpbar1 protein-VLPs

Gene Name

Gpbar1

UniProt

Q80SS6

Expression Region

1-329aa

Organism

Mus musculus (Mouse)

Target Sequence

MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN

Tag

C-terminal 10xHis-tagged

Type

MP-VLP Transmembrane Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. Involved in bile acid promoted GLP1R secretion.

Endotoxin

Not test

Purity

The purity information is not available for VLPs proteins.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Her2 protein Primary Antibodies, Mouse
VACY-1022-CY746 Each

Human Her2 protein Primary Antibodies, Mouse

Sign In for Pricing
View Details
Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)
FY-AB46081-01 1 mL

Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)

Sign In for Pricing
View Details
Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)
FY-AB46081-02 100 µL

Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)

Sign In for Pricing
View Details
Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)
FY-AB46081-03 200 µL

Anti-Elastin Microfibril Interface Located Protein 2 (EMILIN2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe GTP-binding protein ypt1 (ypt1)
MBS1163689-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe GTP-binding protein ypt1 (ypt1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe GTP-binding protein ypt1 (ypt1)
MBS1163689-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe GTP-binding protein ypt1 (ypt1)

Sign In for Pricing
View Details