Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lactadherin (MFGE8)

Product Specifications

Product Name Alternative

MFGM; Milk fat globule-EGF factor 8; MFG-E8; SED1; Sperm surface protein SP47; PP47

Abbreviation

Recombinant Pig MFGE8 protein

Gene Name

MFGE8

UniProt

P79385

Expression Region

1-409aa

Organism

Sus scrofa (Pig)

Target Sequence

FSGDFCDSSLCLNGGTCLLDQDPQKPFHCLCPEGFTGLICNETEKGPCFPNPCHNDAECEVIDDAHRGDVFTEYICKCPHGYTGIHCEIICNAPLGMETGAIADFQISASSMHLGFMGLQRWAPELARLHRAGIVNAWTASNYDRNPWIQVNLLRRMRVTGVVTQGASRAGSAEYMKTFKVAYSTDGRKFQFIQGAEESGDKIFMGNLDNSGLKVNLFEVPLEVQYVRLVPIICHRGCTLRFELLGCELSGCAEPLGLKDNTIPNKQITASSFYRTWGLSAFSWYPFYARLDNQGKFNAWTAQSNSASEWLQIDLGSQRRVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGALEGKIFPGNLDNNSHKKNMFETPFLTRFVRILPVAWHNRITLRVELLGC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Contributes to phagocytic removal of apoptotic cells in many tissues. Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]
TA504285AM 100 µL

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-01 20 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-02 60 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-03 120 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-04 200 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details
VAMP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F2]
TA808605BM 100 µL

VAMP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F2]

Sign In for Pricing
View Details