Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

Product Specifications

Abbreviation

Recombinant Human IL13 protein

Gene Name

IL13

UniProt

P35225

Expression Region

25-146aa

Organism

Homo sapiens (Human)

Target Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit
E-CL-H1167-01 24 Tests

Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit

Sign In for Pricing
View Details
Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit
E-CL-H1167-02 48 Tests

Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit

Sign In for Pricing
View Details
Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit
E-CL-H1167-03 96 Tests

Human GFAP (Glial Fibrillary Acidic Protein) CLIA Kit

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (NM_001869) Human Over-expression Lysate
LC419697 20 µg

Carboxypeptidase A2 (CPA2) (NM_001869) Human Over-expression Lysate

Sign In for Pricing
View Details
Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF640R conjugate, 0.1mg/mL
BNC402267-100 1x 100 µL

Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KAD5 Antibody
8C11988-AAT 50 µg

KAD5 Antibody

Sign In for Pricing
View Details