Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-2 (KLK2)

Product Specifications

Product Name Alternative

Glandular kallikrein-1; hGK-1; Tissue kallikrein-2

Abbreviation

Recombinant Human KLK2 protein

Gene Name

KLK2

UniProt

P20151

Expression Region

25-261aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (MYC909), CF568 conjugate, 0.1mg/mL
BNC680909-100 1x 100 µL

C-Myc (MYC909), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p38 alpha/MAPK14 Recombinant Rabbit Monoclonal Antibody [SR43-04]
ET1602-26 100 µL

p38 alpha/MAPK14 Recombinant Rabbit Monoclonal Antibody [SR43-04]

Sign In for Pricing
View Details
Suppressor of Ty 4 homolog 1 (SUPT4H1) Human Gene Knockout Kit (CRISPR)
KN401211 1 Kit

Suppressor of Ty 4 homolog 1 (SUPT4H1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M5 (CHRM5) Rabbit Polyclonal Antibody
TA367412 100 µL

Muscarinic Acetylcholine Receptor M5 (CHRM5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF551 Human Gene Knockout Kit (CRISPR)
KN401276 1 Kit

ZNF551 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) CLIA Kit
E-CL-M0504-01 24 Tests

Mouse MBP (Myelin Basic Protein) CLIA Kit

Sign In for Pricing
View Details