Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutamine synthetase (GLUL)

Product Specifications

Product Name Alternative

GS; Glutamate--ammonia ligase; Palmitoyltransferase GLUL

Abbreviation

Recombinant Human GLUL protein

Gene Name

GLUL

UniProt

P15104

Expression Region

2-373aa

Organism

Homo sapiens (Human)

Target Sequence

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Glutamine synthetase that catalyzes the ATP-dependent conversion of glutamate and ammonia to glutamine. Its role depends on tissue localization: in the brain, it regulates the levels of toxic ammonia and converts neurotoxic glutamate to harmless glutamine, whereas in the liver, it is one of the enzymes responsible for the removal of ammonia. Essential for proliferation of fetal skin fibroblasts. Independently of its glutamine synthetase activity, required for endothelial cell migration during vascular development: acts by regulating membrane localization and activation of the GTPase RHOJ, possibly by promoting RHOJ palmitoylation. May act as a palmitoyltransferase for RHOJ: able to autopalmitoylate and then transfer the palmitoyl group to RHOJ. Plays a role in ribosomal 40S subunit biogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ager Mouse Gene Knockout Kit (CRISPR)
KN500973 1 Kit

Ager Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACV1B Antibody
8C10576-AAT 50 µg

ACV1B Antibody

Sign In for Pricing
View Details
Mouse Ahi1 activation kit by CRISPRa
GA205537 1 Kit

Mouse Ahi1 activation kit by CRISPRa

Sign In for Pricing
View Details
MIF4GD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]
TA504443AM 100 µL

MIF4GD Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714357 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Cortactin (CTTN) (NM_138565) Human Over-expression Lysate
LC403359 20 µg

Cortactin (CTTN) (NM_138565) Human Over-expression Lysate

Sign In for Pricing
View Details