Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3) (Active)

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

Abbreviation

Recombinant Human IL3 protein (Active)

Gene Name

IL3

UniProt

P08700

Expression Region

20-152aa

Organism

Homo sapiens (Human)

Target Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.1 kDa

References & Citations

The DNA sequence and comparative analysis of human chromosome 5. Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Rubin E.M. Nature 431:268-274 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1306063 Protein Vector (Rat) (pPM-C-His)
PV299237 500 ng

RGD1306063 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Programmed cell death 1 ligand 1
orb1645022-01 50 µg

Programmed cell death 1 ligand 1

Sign In for Pricing
View Details
Programmed cell death 1 ligand 1
orb1645022-02 100 µg

Programmed cell death 1 ligand 1

Sign In for Pricing
View Details
Programmed cell death 1 ligand 1
orb1645022-03 1 mg

Programmed cell death 1 ligand 1

Sign In for Pricing
View Details
P53 antibody
orb2276234-01 0.1 mL

P53 antibody

Sign In for Pricing
View Details
P53 antibody
orb2276234-02 0.5 mL

P53 antibody

Sign In for Pricing
View Details