Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement factor H (CFH), partial

Product Specifications

Product Name Alternative

H factor 1

Abbreviation

Recombinant Human CFH protein, partial

Gene Name

CFH

UniProt

P08603

Expression Region

19-449aa

Organism

Homo sapiens (Human)

Target Sequence

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Glycoprotein that plays an essential role in maintaining a well-balanced immune response by modulating complement activation. Acts as a soluble inhibitor of complement, where its binding to self markers such as glycan structures prevents complement activation and amplification on cell surfaces. Accelerates the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus preventing local formation of more C3b, the central player of the complement amplification loop. As a cofactor of the serine protease factor I, CFH also regulates proteolytic degradation of already-deposited C3b. In addition, mediates several cellular responses through interaction with specific receptors. For example, interacts with CR3/ITGAM receptor and thereby mediates the adhesion of human neutrophils to different pathogens. In turn, these pathogens are phagocytosed and destroyed.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

77.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)
MBS6144105-01 0.1 mL

RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)

Ask
View Details
RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)
MBS6144105-02 5x 0.1 mL

RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)

Ask
View Details
N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide
PC108428-01 100 mg

N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide

Ask
View Details
N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide
PC108428-02 250 mg

N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide

Ask
View Details
N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide
PC108428-03 1 g

N- (2- (1H-1,2,4-Triazol-1-Yl) -5- (Trifluoromethoxy) Phenyl) -4- (Cyclopropylmethoxy) -3-Methoxybenzamide

Ask
View Details
PLEKHG5 Antibody
C47633-01 40 µL

PLEKHG5 Antibody

Ask
View Details