Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

Product Specifications

Product Name Alternative

Sodium-phosphate transport protein 2B; Na+; NaPi3b; Sodium/phosphate cotransporter 2B; Na+; NaPi-2b; Solute carrier family 34 member 2

Abbreviation

Recombinant Human SLC34A2 protein, partial (Active)

Gene Name

SLC34A2

UniProt

O95436

Expression Region

234-362aa

Organism

Homo sapiens (Human)

Target Sequence

VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

Tag

N-terminal 10xHis-tagged and C-terminal mFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Involved in actively transporting phosphate into cells via Na+ cotransport.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU) . The EC50 is 32.86-37.66 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.5 kDa

References & Citations

Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyLight™ Cytotoxicity Assay Kit
ECTX-100 100 Tests

EnzyLight™ Cytotoxicity Assay Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA- 5nm
GP-8005-5 1 mL

Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA- 5nm

Sign In for Pricing
View Details
NOLA1 (GAR1) (NM_032993) Human Recombinant Protein
TP312074 20 µg

NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

Sign In for Pricing
View Details
CLNS1A Rabbit Polyclonal Antibody
AP17217PU-N 400 µL

CLNS1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®350 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20922-50uL 1x 50 µL

CF®350 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF647 conjugate, 0.1mg/mL
BNC472446-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2446), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details