Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)

Product Specifications

Product Name Alternative

Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog; Matrigel-induced gene C4 protein (MIG-C4) ; LYPD3; C4.4A; UNQ491/PRO1007

Abbreviation

Recombinant Human LYPD3 protein (Active)

Gene Name

LYPD3

UniProt

O95274

Expression Region

31-326aa

Organism

Homo sapiens (Human)

Target Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU) . The EC50 is 2.375-2.905 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

The DNA sequence and biology of human chromosome 19. Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Lucas S.M. Nature 428:529-535 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centrin 3 (CETN3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]
TA805871BM 100 µL

Centrin 3 (CETN3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF488A conjugate, 0.1mg/mL
BNC883055-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Igf1 Mouse Gene Knockout Kit (CRISPR)
KN308170BN 1 Kit

Igf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE4A (NM_001111307) Human Over-expression Lysate
LC426362 20 µg

PDE4A (NM_001111307) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat ICTP (Cross-linked C-Telopeptide of Type I Collagen) CLIA Kit
E-CL-R0185-01 24 Tests

Rat ICTP (Cross-linked C-Telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
Rat ICTP (Cross-linked C-Telopeptide of Type I Collagen) CLIA Kit
E-CL-R0185-02 48 Tests

Rat ICTP (Cross-linked C-Telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details