Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)

Product Specifications

Product Name Alternative

Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog; Matrigel-induced gene C4 protein (MIG-C4) ; LYPD3; C4.4A; UNQ491/PRO1007

Abbreviation

Recombinant Human LYPD3 protein (Active)

Gene Name

LYPD3

UniProt

O95274

Expression Region

31-326aa

Organism

Homo sapiens (Human)

Target Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU) . The EC50 is 2.375-2.905 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

The DNA sequence and biology of human chromosome 19. Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Lucas S.M. Nature 428:529-535 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(2-chloroisopropyl) Ether
TRC-B419020-10MG 10 mg

Bis(2-chloroisopropyl) Ether

Sign In for Pricing
View Details
ISCU Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F5]
TA803397BM 100 µL

ISCU Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F5]

Sign In for Pricing
View Details
CCN1 (CYR61) (NM_001554) Human Recombinant Protein
TP750169 50 µg

CCN1 (CYR61) (NM_001554) Human Recombinant Protein

Sign In for Pricing
View Details
SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)
KN210866BN 1 Kit

SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCYT1B Human Gene Knockout Kit (CRISPR)
KN416978 1 Kit

PCYT1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), Biotin conjugate, 0.1mg/mL
BNCB3283-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details