Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6) -Detergent (Active)

Product Specifications

Product Name Alternative

UNQ757; PRO1488

Abbreviation

Recombinant Human CLDN6 protein-Detergent (Active)

Gene Name

CLDN6

UniProt

P56747

Expression Region

2-220aa

Organism

Homo sapiens (Human)

Target Sequence

ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Tag

N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

Type

MP-Detergent Transmembrane Protein & Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Plays a major role in tight junction-specific obliteration of the intercellular space. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU) . The EC50 is 1.243-2.426 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered DDM/CHS, 50 mM HEPES, 150 mM NaCl, 6% Trehalose, pH 7.5.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.7 kDa

References & Citations

"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003) "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pan-Actin Recombinant Mouse monoclonal Antibody
HA610160 100 µg

Pan-Actin Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), 0.2mg/mL
BNUB2353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS702594 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)
HA601223 100 µg

NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS707061 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
P2RX4 (NM_002560) Human Over-expression Lysate
LC419264 20 µg

P2RX4 (NM_002560) Human Over-expression Lysate

Sign In for Pricing
View Details