Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial (Active)

Product Specifications

Product Name Alternative

4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276

Abbreviation

Recombinant Human CD276 protein, partial (Active)

Gene Name

CD276

UniProt

Q5ZPR3-2

Expression Region

29-245aa

Organism

Homo sapiens (Human)

Target Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody (CSB-RA733578MA1HU) . The EC50 is 47.12-54.16 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.7 kDa

References & Citations

The immunomodulatory proteins B7-DC, B7-H2, and B7-H3 are differentially expressed across gestation in the human placenta. Petroff M.G., Kharatyan E., Torry D.S., Holets L. Am. J. Pathol. 167:465-473 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLI-06, Notch pathway inhibitor
TBI1504-25MG 25 mg

FLI-06, Notch pathway inhibitor

Sign In for Pricing
View Details
Lentiviral mouse Fto shRNA (UAS) - Lentiviral mouse Fto shRNA (UAS, RFP) (100)
GTR15274224 1 Vial

Lentiviral mouse Fto shRNA (UAS) - Lentiviral mouse Fto shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ABI2 Knockout jurkat Polyclonal Cells
ARG33700 1 Million

ABI2 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Protein (N-His, RVFV)
P514681 100 µg

Protein (N-His, RVFV)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Cytochrome c oxidase assembly protein COX19 (COX19)
MBS1137112-01 0.05 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Cytochrome c oxidase assembly protein COX19 (COX19)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Cytochrome c oxidase assembly protein COX19 (COX19)
MBS1137112-02 0.2 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Cytochrome c oxidase assembly protein COX19 (COX19)

Sign In for Pricing
View Details