Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bos indicus x Bos taurus Alpha-S1-casein (111:E→Missing, △140-149), partial

Product Specifications

Abbreviation

Recombinant Bos indicus x Bos taurus Alpha-S1-casein protein (Mutant type), partial

UniProt

A0A4W2D9P4

Expression Region

56-181aa (111:E→Missing, △140-149)

Organism

Bos indicus x Bos taurus (Hybrid cattle)

Target Sequence

SKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLIVPNSAEERLHSMKEGIHAQQKEPMIGVLFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Important role in the capacity of milk to transport calcium phosphate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL10AP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40742061 1.0 µg DNA

RPL10AP8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LUM, NT (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (APC)
MBS6485540-01 0.2 mL

LUM, NT (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (APC)

Sign In for Pricing
View Details
LUM, NT (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (APC)
MBS6485540-02 5x 0.2 mL

LUM, NT (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (APC)

Sign In for Pricing
View Details
RHD Protein Vector (Rat) (pPB-N-His)
PV301359 500 ng

RHD Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Phospho-MYPT1 (Thr696) Rabbit Polyclonal Antibody (BF488)
orb1609414 100 µL

Phospho-MYPT1 (Thr696) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
TRIB2 Antibody
MBS9604206-01 0.1 mL

TRIB2 Antibody

Sign In for Pricing
View Details