Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Podocin (NPHS2), Partial

Product Specifications

Abbreviation

Recombinant Human NPHS2 protein, partial

Gene Name

NPHS2

UniProt

Q9NP85

Expression Region

124-315aa

Organism

Homo sapiens (Human)

Target Sequence

CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAAR7P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV786673 1.0 µg DNA

TAAR7P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Guinea pig Angiotension II receptor Antibody ELISA Kit
MBS727474-01 48 Well

Guinea pig Angiotension II receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Angiotension II receptor Antibody ELISA Kit
MBS727474-02 96 Well

Guinea pig Angiotension II receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Angiotension II receptor Antibody ELISA Kit
MBS727474-03 5x 96 Well

Guinea pig Angiotension II receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Angiotension II receptor Antibody ELISA Kit
MBS727474-04 10x 96 Well

Guinea pig Angiotension II receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 17 (Keratin, Type I Cytoskeletal 17, Cytokeratin-17, Short name=CK-17, CK17, Keratin-17, Short name=K17, KRT17, Keratin17, Cytokeratin17) discontinued
222054-01 50 µL

Cytokeratin 17 (Keratin, Type I Cytoskeletal 17, Cytokeratin-17, Short name=CK-17, CK17, Keratin-17, Short name=K17, KRT17, Keratin17, Cytokeratin17) discontinued

Sign In for Pricing
View Details