Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 96 (LY96)

Product Specifications

Product Name Alternative

Ly-96; ESOP-1; Protein MD-2

Abbreviation

Recombinant Human LY96 protein

Gene Name

LY96

UniProt

Q9Y6Y9

Expression Region

19-160aa

Organism

Homo sapiens (Human)

Target Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Binds bacterial lipopolysaccharide (LPS) . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHTF2 (Center) Rabbit Polyclonal Antibody
AP53290PU-N 400 µL

PHTF2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NLRP11 (NM_001297743) Human Tagged ORF Clone
RG239798 10 µg

NLRP11 (NM_001297743) Human Tagged ORF Clone

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PCSK9 Antibody Pair Set
E-KAB-0061 50 µL & 100 µg

Human PCSK9 Antibody Pair Set

Sign In for Pricing
View Details
Dithiocarbonic Acid S,S'-Diethyl Ester
TRC-D493180-1G 1 g

Dithiocarbonic Acid S,S'-Diethyl Ester

Sign In for Pricing
View Details
2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride
TRC-D367020-10MG 10 mg

2-(Diethylamino)ethyl 3-amino-4-(2-(diethylamino)ethoxy)benzoate Hydrochloride

Sign In for Pricing
View Details