Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 96 (LY96)

Product Specifications

Product Name Alternative

Ly-96; ESOP-1; Protein MD-2

Abbreviation

Recombinant Human LY96 protein

Gene Name

LY96

UniProt

Q9Y6Y9

Expression Region

19-160aa

Organism

Homo sapiens (Human)

Target Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Binds bacterial lipopolysaccharide (LPS) . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENT2 (SLC29A2) (NM_001532) Human Over-expression Lysate
LC400588 20 µg

ENT2 (SLC29A2) (NM_001532) Human Over-expression Lysate

Sign In for Pricing
View Details
2’,3’-Isopropylidene Adenosine-13C5
TRC-I824677-5MG 5 mg

2’,3’-Isopropylidene Adenosine-13C5

Sign In for Pricing
View Details
RPL24 Rabbit Polyclonal Antibody
TA381047 100 µL

RPL24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human MCP3/CCL7 protein (His tag)
PDEH100758-01 20 µg

Recombinant Human MCP3/CCL7 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MCP3/CCL7 protein (His tag)
PDEH100758-02 100 µg

Recombinant Human MCP3/CCL7 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MCP3/CCL7 protein (His tag)
PDEH100758-03 500 µg

Recombinant Human MCP3/CCL7 protein (His tag)

Sign In for Pricing
View Details