Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-associated protein tau (MAPT), partial

Product Specifications

Product Name Alternative

(Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)

Abbreviation

Recombinant Human MAPT protein, partial

Gene Name

MAPT

UniProt

P10636-1

Expression Region

561-685aa

Organism

Homo sapiens (Human)

Target Sequence

QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by TAU/MAPT localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 1

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal KLF13 Antibody [Alexa Fluor 350]
NBP2-98809AF350 0.1 mL

Rabbit Polyclonal KLF13 Antibody [Alexa Fluor 350]

Ask
View Details
HGCN5, CT (KAT2A, GCN5, GCN5L2, HGCN5, Histone acetyltransferase KAT2A, General control of amino acid synthesis protein 5-like 2, Histone acetyltransferase GCN5, Lysine acetyltransferase 2A, STAF97) (MaxLight 650) discontinued
036531-ML650 100 µL

HGCN5, CT (KAT2A, GCN5, GCN5L2, HGCN5, Histone acetyltransferase KAT2A, General control of amino acid synthesis protein 5-like 2, Histone acetyltransferase GCN5, Lysine acetyltransferase 2A, STAF97) (MaxLight 650) discontinued

Ask
View Details
XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (AP) discontinued
135467-AP 100 µL

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (AP) discontinued

Ask
View Details
ZNF304 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51431151 3x 1.0 µg DNA

ZNF304 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Recombinant Lucihormetica verrucosa Hypertrehalosaemic factor
MBS1232989-01 0.05 mg (E-Coli)

Recombinant Lucihormetica verrucosa Hypertrehalosaemic factor

Ask
View Details
Recombinant Lucihormetica verrucosa Hypertrehalosaemic factor
MBS1232989-02 0.2 mg (E-Coli)

Recombinant Lucihormetica verrucosa Hypertrehalosaemic factor

Ask
View Details