Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial (Active)

Product Specifications

Product Name Alternative

(Activation inducer molecule) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60)

Abbreviation

Recombinant Human CD69 protein, partial (Active)

Gene Name

CD69

UniProt

Q07108

Expression Region

62-199aa

Organism

Homo sapiens (Human)

Target Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May function as a signal transmitting receptor.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.7 kDa

References & Citations

"Crystal structure of human CD69: a C-type lectin-like activation marker of hematopoietic cells." Natarajan K., Sawicki M.W., Margulies D.H., Mariuzza R.A. Biochemistry 39:14779-14786 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Amyloid beta A4 protein, APP ELISA Kit
MBS9328666-01 48 Well

Bovine Amyloid beta A4 protein, APP ELISA Kit

Sign In for Pricing
View Details
Bovine Amyloid beta A4 protein, APP ELISA Kit
MBS9328666-02 96 Well

Bovine Amyloid beta A4 protein, APP ELISA Kit

Sign In for Pricing
View Details
Bovine Amyloid beta A4 protein, APP ELISA Kit
MBS9328666-03 5x 96 Well

Bovine Amyloid beta A4 protein, APP ELISA Kit

Sign In for Pricing
View Details
Bovine Amyloid beta A4 protein, APP ELISA Kit
MBS9328666-04 10x 96 Well

Bovine Amyloid beta A4 protein, APP ELISA Kit

Sign In for Pricing
View Details
P2RX2 (Purinergic Receptor P2X, Ligand-gated Ion Channel, 2, MGC129601, P2X2) (HRP)
249693-HRP 100 µL

P2RX2 (Purinergic Receptor P2X, Ligand-gated Ion Channel, 2, MGC129601, P2X2) (HRP)

Sign In for Pricing
View Details
Prostaglandin E Synthase Rabbit pAb
APA4019-01 30 µL

Prostaglandin E Synthase Rabbit pAb

Sign In for Pricing
View Details