Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Locusta migratoria OBP10 protein (OBP10) (I18L, V57I, N131Q)

Product Specifications

Abbreviation

Recombinant Locusta migratoria OBP10 protein (I18L, V57I, N131Q)

Gene Name

OBP10

UniProt

H2CSN4

Expression Region

1-133aa (I18L, V57I, N131Q)

Organism

Locusta migratoria (Migratory locust)

Target Sequence

AISESMSRAEEAASKIDLPELFEECNETFTIPKVTLNYFFSHGRLQNENDYGSKCFIHCLTDRSGEIDSDGNFDVDLIKVMTRRFPNETNIEGLNEMVETCVADRGETDFCERAYGLVSCLVKEKLARLGQSH

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Integral membrane protein associated with integrins, which regulates different processes, such as sperm-egg fusion, platelet activation and aggregation, and cell adhesion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.1 kDa

References & Citations

"Molecular cloning of the mouse equivalent of CD9 antigen." Rubinstein E., Billard M., Plaisance S., Prenant M., Boucheix C. Thromb. Res. 71:377-383 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tra-2α Antibody
C11000-01 50 μL

Tra-2α Antibody

Sign In for Pricing
View Details
Tra-2α Antibody
C11000-02 100 µL

Tra-2α Antibody

Sign In for Pricing
View Details
Mouse Thyroxine antibody, TAb ELISA Kit
NB-E20392 96 Well

Mouse Thyroxine antibody, TAb ELISA Kit

Sign In for Pricing
View Details
FGF17 Human shRNA Lentiviral Particle (Locus ID 8822)
TL312991V 500 µL Each

FGF17 Human shRNA Lentiviral Particle (Locus ID 8822)

Sign In for Pricing
View Details
Nudt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7080305 3x 1.0 µg

Nudt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Glypican 5 (GPC5) (NM_004466) Human Mass Spec Standard
PH307909 10 µg

Glypican 5 (GPC5) (NM_004466) Human Mass Spec Standard

Sign In for Pricing
View Details