Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

Product Specifications

Product Name Alternative

(BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING-type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY-REN-63)

Abbreviation

Recombinant Human BRAP protein, partial

Gene Name

BRAP

UniProt

Q7Z569

Expression Region

2-262aa

Organism

Homo sapiens (Human)

Target Sequence

SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKGGGGSGGGGSEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPLE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.5 kDa

References & Citations

Identification of a novel Cytoplasmic domain protein that specifically binds to nuclear localization signal motifs.Li S., Ku C.-Y., Farmer A.A., Cong Y.-S., Chen C.-F., Lee W.-H.J. Biol. Chem. 273:6183-6189 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM271 activation kit by CRISPRa
GA120074 1 Kit

Human TMEM271 activation kit by CRISPRa

Sign In for Pricing
View Details
Transglutaminase 5 (TGM5) (NM_201631) Human Recombinant Protein
TP315126L 1 mg

Transglutaminase 5 (TGM5) (NM_201631) Human Recombinant Protein

Sign In for Pricing
View Details
N- (1, 10-phenanthrolin-5-yl) iodoacetamide
#92015 1x 5 mg

N- (1, 10-phenanthrolin-5-yl) iodoacetamide

Sign In for Pricing
View Details
SDF1 Antibody (Biotin)
KB-7363-01 50 μL

SDF1 Antibody (Biotin)

Sign In for Pricing
View Details
SDF1 Antibody (Biotin)
KB-7363-02 100 µL

SDF1 Antibody (Biotin)

Sign In for Pricing
View Details
SDF1 Antibody (Biotin)
KB-7363-03 1 mL

SDF1 Antibody (Biotin)

Sign In for Pricing
View Details