Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Locusta migratoria OBP10 protein (OBP10) (I18L, V57I, N131Q)

Product Specifications

Abbreviation

Recombinant Locusta migratoria OBP10 protein (I18L, V57I, N131Q)

Gene Name

OBP10

UniProt

H2CSN4

Expression Region

1-133aa (I18L, V57I, N131Q)

Organism

Locusta migratoria (Migratory locust)

Target Sequence

AISESMSRAEEAASKIDLPELFEECNETFTIPKVTLNYFFSHGRLQNENDYGSKCFIHCLTDRSGEIDSDGNFDVDLIKVMTRRFPNETNIEGLNEMVETCVADRGETDFCERAYGLVSCLVKEKLARLGQSH

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.0 kDa

References & Citations

"Identification and characterization of novel odorant-binding proteins (OBPs) in locust transcriptomes of two phases." Guo W., Wang X., Kang L. Submitted (JUN-2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MSS51 knockdown cell line
ABC-KD9568 1 Vial

Human MSS51 knockdown cell line

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica cysS Protein (aa 1-461) (strain 8081)
VAng-Cr1797-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica cysS Protein (aa 1-461) (strain 8081)

Sign In for Pricing
View Details
Recombinant Populus euphratica Cysteine synthase
MBS1009300-01 0.05 mg (E-Coli)

Recombinant Populus euphratica Cysteine synthase

Sign In for Pricing
View Details
Recombinant Populus euphratica Cysteine synthase
MBS1009300-02 0.2 mg (E-Coli)

Recombinant Populus euphratica Cysteine synthase

Sign In for Pricing
View Details
Recombinant Populus euphratica Cysteine synthase
MBS1009300-03 0.05 mg (Yeast)

Recombinant Populus euphratica Cysteine synthase

Sign In for Pricing
View Details
Recombinant Populus euphratica Cysteine synthase
MBS1009300-04 0.5 mg (E-Coli)

Recombinant Populus euphratica Cysteine synthase

Sign In for Pricing
View Details