Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Maltase-glucoamylase (MGAM), partial

Product Specifications

Product Name Alternative

(Alpha-1,4-glucosidase)

Abbreviation

Recombinant Human MGAM protein, partial

Gene Name

MGAM

UniProt

O43451

Expression Region

87-954aa

Organism

Homo sapiens (Human)

Target Sequence

SAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEW

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Alpha- (1,4) exo-glucosidase involved in breakdown of dietary starch oligosaccharides in small intestine. Cleaves the non-reducing alpha- (1,4) -linked glucose residue in linear dextrins with retention of anomeric center stereochemistry . Mainly hydrolyzes short length oligomaltoses having two to seven glucose residues . Can cleave alpha- (1,2), alpha- (1,3) and alpha- (1,6) glycosidic linkages with lower efficiency, whereas beta glycosidic linkages are usually not hydrolyzed .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

101.1 kDa

References & Citations

"Contribution of the Individual Small Intestinal alpha-Glucosidases to Digestion of Unusual alpha-Linked Glycemic Disaccharides." Lee B.H., Rose D.R., Lin A.H., Quezada-Calvillo R., Nichols B.L., Hamaker B.R. J. Agric. Food Chem. 64:6487-6494 (2016)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-500 1x 500 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF740 conjugate, 0.1mg/mL
BNC742488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details