What sizes are available for Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)?

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) come in?

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is available in 3 different pack sizes.

Who manufactures Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)?

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)?

Estimated delivery time for Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is approximately 15 business day(s), depending on your location.

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)

Q: What is the catalog number for Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A)?

The catalog number for Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is CSB-EP006519MO (M).

Q: Is Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) in stock?

Recombinant Mouse Acyl-CoA-binding protein (Dbi) (K33A) is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

Product Name Alternative

(ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP)

Abbreviation

Recombinant Mouse Dbi protein (K33A)

Gene Name

Dbi

UniProt

P31786

Expression Region

1-87aa (K33A)

Organism

Mus musculus (Mouse)

Target Sequence

MSQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFAQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.