Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6) -VLPs (Active)

Product Specifications

Product Name Alternative

(Skullin)

Abbreviation

Recombinant Human CLDN6 protein-VLPs (Active)

Gene Name

CLDN6

UniProt

P56747

Expression Region

1-220aa

Organism

Homo sapiens (Human)

Target Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Type

MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Plays a major role in tight junction-specific obliteration of the intercellular space. ; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU) . The EC50 is 1.334-1.504 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody (CSB-RA005508MA2HU) . The EC50 is 2.920-3.812 ng/mL.The VLPs (CSB-MP3838) is negative control. ③Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA3HU) . The EC50 is 3.482-4.097 ng/mL.The VLPs (CSB-MP3838) is negative control. ④Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody (CSB-RA005508MA4HU) . The EC50 is 2.866-3.739 ng/mL.The VLPs (CSB-MP3838) is negative control.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

24.8 kDa

References & Citations

"Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-PICK1 Antibody (L20/8)
RHK68802 100 μg

Anti-PICK1 Antibody (L20/8)

Ask
View Details
Rabbit Polyclonal Afadin/AF-6 Antibody
NBP2-55781-25ul 25 µL

Rabbit Polyclonal Afadin/AF-6 Antibody

Ask
View Details
Human Fructose-26-bisphosphatase TIGAR,TIGAR ELISA KIT
JOT-EK7101Hu 96 wells

Human Fructose-26-bisphosphatase TIGAR,TIGAR ELISA KIT

Ask
View Details
4-1BB Ligand (TNFSF9, CD137, CDw137, ILA, MGC2172, T-cell, 4-1BB Homolog, T-cell Antigen ILA, Tumor Necrosis Factor Receptor Superfamily Member 9 Precursor) (PE) discontinued
143547-PE 100 µL

4-1BB Ligand (TNFSF9, CD137, CDw137, ILA, MGC2172, T-cell, 4-1BB Homolog, T-cell Antigen ILA, Tumor Necrosis Factor Receptor Superfamily Member 9 Precursor) (PE) discontinued

Ask
View Details
Rabbit Polyclonal GRAP Antibody
NBP2-16737 0.1 mL

Rabbit Polyclonal GRAP Antibody

Ask
View Details
Recombinant Nicotiana tabacum Sucrose-phosphatase 1 (SPP1)
MBS1466691-01 0.02 mg (E-Coli)

Recombinant Nicotiana tabacum Sucrose-phosphatase 1 (SPP1)

Ask
View Details