Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (K417N), partial

Product Specifications

Product Name Alternative

E2 Peplomer protein

Abbreviation

Recombinant SARS-CoV-2 S protein (K417N), partial

Gene Name

S

UniProt

P0DTC2

Expression Region

319-541aa (K417N)

Organism

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Target Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Tag

C-terminal mFc-tagged

Type

In Stock Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-01 0.02 mg (E-Coli)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details
Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-02 0.1 mg (E-Coli)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details
Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-03 0.02 mg (Yeast)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details
Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-04 0.1 mg (Yeast)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details
Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-05 0.02 mg (Baculovirus)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details
Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)
MBS1134049-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylothermus marinus Aspartate carbamoyltransferase regulatory chain (pyrI)

Sign In for Pricing
View Details