Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (W436R), partial (Active)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant SARS-CoV-2 S protein (W436R), partial (Active)

Gene Name

S

UniProt

P0DTC2

Expression Region

319-541aa (W436R)

Organism

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Target Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIARNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (W436R) at 2 μg/ml can bind Biotinylated human ACE2 (CSB-MP866317HU-B), the EC50 is 625.3-783.2 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXER1 Peptide - C-terminal region
MBS3242002-01 0.1 mg

OXER1 Peptide - C-terminal region

Sign In for Pricing
View Details
OXER1 Peptide - C-terminal region
MBS3242002-02 5x 0.1 mg

OXER1 Peptide - C-terminal region

Sign In for Pricing
View Details
DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (APC)
125895-APC 100 µL

DLX3 (Distal-less Homeobox 3, DLX 3, AI4, Homeobox Protein DLX 3, TDO) (APC)

Sign In for Pricing
View Details
Human Glycocalicin, GC ELISA KIT
E3792Hu-01 48 Well

Human Glycocalicin, GC ELISA KIT

Sign In for Pricing
View Details
Human Glycocalicin, GC ELISA KIT
E3792Hu-02 96 Well

Human Glycocalicin, GC ELISA KIT

Sign In for Pricing
View Details
Human Glycocalicin, GC ELISA KIT
E3792Hu-03 5x 96 Tests

Human Glycocalicin, GC ELISA KIT

Sign In for Pricing
View Details