Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2)

Product Specifications

Product Name Alternative

Potassium voltage-gated channel subfamily E member 2 (MinK-related peptide 1) (Minimum potassium ion channel-related peptide 1) (Potassium channel subunit beta MiRP1)

Abbreviation

Recombinant Human KCNE2 protein

Gene Name

KCNE2

UniProt

Q9Y6J6

Expression Region

1-123aa

Organism

Homo sapiens (Human)

Target Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr) . May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current. Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (PubMed:11101505) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel." Tinel N., Diochot S., Borsotto M., Lazdunski M., Barhanin J. EMBO J. 19:6326-6330 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CDCP1 Antibody (309116) [DyLight 550]
FAB26663L 0.1 mL

Mouse Monoclonal CDCP1 Antibody (309116) [DyLight 550]

Ask
View Details
Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated
MBS1489533-01 0.05 mg

Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated
MBS1489533-02 0.1 mg

Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated

Ask
View Details
Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated
MBS1489533-03 5x 0.1 mg

Rabbit anti-Bacillus thuringiensis subsp Pesticidal crystal protein cry1Ac polyclonal Antibody, Biotin conjugated

Ask
View Details
Tefinostat 100mg
A20258-100 100 mg

Tefinostat 100mg

Ask
View Details
Anti-MOB4 antibody
STJ26745 100 µl

Anti-MOB4 antibody

Ask
View Details