Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosomonas europaea Cytochrome P460 (cyp) (R70M)

Product Specifications

Abbreviation

Recombinant Nitrosomonas europaea Cytochrome P460 protein (R70M)

Gene Name

Cyp

UniProt

Q50927

Expression Region

27-198aa (R70M)

Organism

Nitrosomonas europaea (bioreactor metagenome)

Target Sequence

AGVAEFNDKGELLLPKNYREWVMVGTQVTPNELNDGKAPFTEIMTVYVDPESYAHWKKTGEFRDGTVTVKELVSVGDRKGPGSGNGYFMGDYIGLEASVKDSQRFANEPGNWAFYIFYVPDTPLVAAAKNLPTAECAACHKENAKTDMVFTQFYPVLRAAKATGESGVVAPK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.7 kDa

References & Citations

"The crystal structure of cytochrome P460 of Nitrosomonas europaea reveals a novel cytochrome fold and heme-protein cross-link." Pearson A.R., Elmore B.O., Yang C., Ferrara J.D., Hooper A.B., Wilmot C.M. Biochemistry 46:8340-8349 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-500 1x 500 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF594 conjugate, 0.1mg/mL
BNC941170-100 1x 100 µL

Vimentin (VM1170), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
BNC470841-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF405S conjugate, 0.1mg/mL
BNC042044-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details