Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) (C225S)

Product Specifications

Product Name Alternative

Enoyl-CoA hydratase 1 Short-chain enoyl-CoA hydratase

Abbreviation

Recombinant Mouse Echs1 protein (C225S)

Gene Name

Echs1

UniProt

Q8BH95

Expression Region

28-290aa (C225S)

Organism

Mus musculus (Mouse)

Target Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Tag

N-terminal 10xHis-tagged and C-terminal HA-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate (By similarity) . Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.0 kDa

References & Citations

"Type 2 diabetic obese db/db mice are refractory to myocardial ischaemic post-conditioning in vivo: potential role for Hsp20, F1-ATPase delta and Echs1." Zhu S.G., Xi L., Kukreja R.C. J. Cell. Mol. Med. 16:950-958 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INTS10 Polyclonal Antibody
MBS2554999-01 0.06 mL

INTS10 Polyclonal Antibody

Sign In for Pricing
View Details
INTS10 Polyclonal Antibody
MBS2554999-02 0.12 mL

INTS10 Polyclonal Antibody

Sign In for Pricing
View Details
INTS10 Polyclonal Antibody
MBS2554999-03 0.2 mL

INTS10 Polyclonal Antibody

Sign In for Pricing
View Details
INTS10 Polyclonal Antibody
MBS2554999-04 5x 0.2 mL

INTS10 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human VEGFA protein
IMP-623 20 µg

Recombinant Human VEGFA protein

Sign In for Pricing
View Details
ARHGAP25 siRNA (Human)
MBS8212170-01 15 nmol

ARHGAP25 siRNA (Human)

Sign In for Pricing
View Details