Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Titin (TTN), partial

Product Specifications

Product Name Alternative

ConnectinRhabdomyosarcoma antigen MU-RMS-40.14

Abbreviation

Recombinant Human TTN protein, partial

Gene Name

TTN

UniProt

Q8WZ42

Expression Region

5398-5604aa

Organism

Homo sapiens (Human)

Target Sequence

VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Key component in the assbly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, ses to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.

Molecular Weight

27.1 kDa

References & Citations

Titins, giant proteins in charge of muscle ultrastructure and elasticity.Labeit S., Kolmerer B.Science 270:293-296 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 6

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF647 conjugate, 0.1mg/mL
BNC472362-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CCL19/MIP-3 beta ELISA Kit
EA100316 96 Well

Human CCL19/MIP-3 beta ELISA Kit

Sign In for Pricing
View Details
Octyl cis-9-Octadecenoate
TRC-O845803-5G 5 g

Octyl cis-9-Octadecenoate

Sign In for Pricing
View Details
Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit
E-CL-H0562-01 24 Tests

Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit

Sign In for Pricing
View Details
Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit
E-CL-H0562-02 48 Tests

Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit

Sign In for Pricing
View Details
Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit
E-CL-H0562-03 96 Tests

Human COL8α1 (Collagen Type VIII Alpha 1) CLIA Kit

Sign In for Pricing
View Details