Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase ERas (ERAS), partial

Product Specifications

Product Name Alternative

Embryonic stem cell-expressed Ras

Abbreviation

Recombinant Human ERAS protein, partial

Gene Name

ERAS

UniProt

Q7Z444

Expression Region

3-230aa

Organism

Homo sapiens (Human)

Target Sequence

LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells (By similarity) .

Molecular Weight

28.8 kDa

References & Citations

Role of Eras in promoting tumor-like properties in mouse embryonic stem cells.Takahashi K., Mitsui K., Yamanaka S.Nature 423:541-545 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cyp3a13 activation kit by CRISPRa
GA200994 1 Kit

Mouse Cyp3a13 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A FMP
HA12516008.25G 25 g

Polystyrene A FMP

Sign In for Pricing
View Details
UGT2B10 (NM_001075) Human Over-expression Lysate
LC421349 20 µg

UGT2B10 (NM_001075) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Conjugated Anti-Mouse CD8 alpha Recombinant Antibody [PSH05-00] - Rabbit IgG (Chimeric)
HA720205F 100 µL

FITC Conjugated Anti-Mouse CD8 alpha Recombinant Antibody [PSH05-00] - Rabbit IgG (Chimeric)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB512085 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Recombinant Transcription Initiation Factor IIB Antibody
RC-16151-01 50 μL

Recombinant Transcription Initiation Factor IIB Antibody

Sign In for Pricing
View Details