Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase ERas (ERAS), partial

Product Specifications

Product Name Alternative

Embryonic stem cell-expressed Ras

Abbreviation

Recombinant Human ERAS protein, partial

Gene Name

ERAS

UniProt

Q7Z444

Expression Region

3-230aa

Organism

Homo sapiens (Human)

Target Sequence

LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells (By similarity) .

Molecular Weight

28.8 kDa

References & Citations

Role of Eras in promoting tumor-like properties in mouse embryonic stem cells.Takahashi K., Mitsui K., Yamanaka S.Nature 423:541-545 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAGEH1 activation kit by CRISPRa
GA109191 1 Kit

Human MAGEH1 activation kit by CRISPRa

Sign In for Pricing
View Details
Triprolidine Hydrochloride
TRC-T814000-50G 50 g

Triprolidine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS502886 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Steap4 Mouse Gene Knockout Kit (CRISPR)
KN516858 1 Kit

Steap4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant DR5 Monoclonal Antibody
AN301856L-01 50 µL

Recombinant DR5 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant DR5 Monoclonal Antibody
AN301856L-02 100 µL

Recombinant DR5 Monoclonal Antibody

Sign In for Pricing
View Details