Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tenascin (TNC), partial

Product Specifications

Product Name Alternative

Cytotactin; GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin; Tenascin-C ; TN-C

Abbreviation

Recombinant Human TNC protein, partial

Gene Name

TNC

UniProt

P24821

Expression Region

1888-2201aa

Organism

Homo sapiens (Human)

Target Sequence

DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Extracellular domain matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells

Molecular Weight

39.6 kDa

References & Citations

An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glomerular Podocytes
cAP-m0022 1 Frozen Vial

Mouse Glomerular Podocytes

Sign In for Pricing
View Details
Sheep ADAMTS like protein 3 (ADAMTSL3) ELISA Kit
GTR10328398 96 Well

Sheep ADAMTS like protein 3 (ADAMTSL3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Cytokine-inducible SH2-containing protein Protein, GST, E.coli-200ug
QP8202-ec-200ug 200ug

Recombinant Human Cytokine-inducible SH2-containing protein Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
Pnpla3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4494108 1.0 µg DNA

Pnpla3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
P21, WAF1 (Cip1, Sdi1, Pic1, Wild-type p53-activated Fragment, Tumor Suppressor Protein) (BSA & Azide Free) (MaxLight 550) discontinued
P1000-54X-ML550 100 µL

P21, WAF1 (Cip1, Sdi1, Pic1, Wild-type p53-activated Fragment, Tumor Suppressor Protein) (BSA & Azide Free) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FASTK Protein Vector (Rat) (pPB-N-His)
PV267835 500 ng

FASTK Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details