Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 2 (Cxcl2)

Product Specifications

Product Name Alternative

Macrophage inflammatory protein 2 ; MIP2

Abbreviation

Recombinant Mouse Cxcl2 protein

Gene Name

Cxcl2

UniProt

P10889

Expression Region

28-100aa

Organism

Mus musculus (Mouse)

Target Sequence

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.

Molecular Weight

11.8 kDa

References & Citations

Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL
BNC470054-100 1x 100 µL

HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF594 conjugate, 0.1mg/mL
BNC942465-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL
BNC681198-500 1x 500 µL

Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details