Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Valacyclovir hydrolase (BPHL)

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

Abbreviation

Recombinant Human BPHL protein

Gene Name

BPHL

UniProt

Q86WA6

Expression Region

38-291aa

Organism

Homo sapiens (Human)

Target Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.

Molecular Weight

33.8 kDa

References & Citations

"Cloning and expression analysis of a novel human serine hydrolase with sequence similarity to prokaryotic enzymes involved in the degradation of aromatic compounds." Puente X.S., Lopez-Otin C. J. Biol. Chem. 270:12926-12932 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SP3 (NM_003111) Human Tagged ORF Clone Lentiviral Particle
RC222027L1V 200 µL

SP3 (NM_003111) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Anti-B tag Polyclonal Antibody
MF-0067774 40 µg

Anti-B tag Polyclonal Antibody

Ask
View Details
SSC5D Human shRNA Lentiviral Particle (Locus ID 284297)
TL319656V 500 µL Each

SSC5D Human shRNA Lentiviral Particle (Locus ID 284297)

Ask
View Details
ALPK1 (NM_025144) Human Tagged ORF Clone Lentiviral Particle
RC209189L3V 200 µL

ALPK1 (NM_025144) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
CHD3 Protein (N-His, Human)
P502502 100 µg

CHD3 Protein (N-His, Human)

Ask
View Details