Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-37 (IL37)

Product Specifications

Product Name Alternative

FIL1 zeta IL-1X Interleukin-1 family member 7

Abbreviation

Recombinant Human IL37 protein

Gene Name

IL37

UniProt

Q9NZH6

Expression Region

1-218aa

Organism

Homo sapiens (Human)

Target Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Molecular Weight

51.1 kDa

References & Citations

"Identification and initial characterization of four novel members of the interleukin-1 family." Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R. J. Biol. Chem. 275:10308-10314 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block, multipurpose for liquids, beads, etc. Chamber dimensions: 4 x 2.6 x 1"
H5000-WB 1 Each

Block, multipurpose for liquids, beads, etc. Chamber dimensions: 4 x 2.6 x 1"

Sign In for Pricing
View Details
TentaGel® S COOH
S30903.25G 25 g

TentaGel® S COOH

Sign In for Pricing
View Details
LXN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E10]
TA503779AM 100 µL

LXN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E10]

Sign In for Pricing
View Details
11-Ketoprogesterone
TRC-K201000-500MG 500 mg

11-Ketoprogesterone

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL
BNC041718-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Isopropyl-3-(4-fluorophenyl)indole-d7
TRC-I824527-5MG 5 mg

1-Isopropyl-3-(4-fluorophenyl)indole-d7

Sign In for Pricing
View Details