Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 14 (CCL14)

Product Specifications

Product Name Alternative

Chemokine CC-1/CC-3 ; HCC-1/HCC-3HCC-1 (1-74) NCC-2Small-inducible cytokine A14

Abbreviation

Recombinant Human CCL14 protein

Gene Name

CCL14

UniProt

Q16627

Expression Region

20-93aa

Organism

Homo sapiens (Human)

Target Sequence

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca2+ changes and enzyme release, but no chotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1 (9-74) is a chotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca (2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1 (9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Molecular Weight

24.7 kDa

References & Citations

HCC-1, a novel chemokine from human plasma.Schulz-Knappe P., Maegert H.-J., Dewald B., Meyer M., Cetin Y., Kubbies M., Tomeczkowski J., Kirchhoff K., Raida M., Adermann K., Kist A., Reinecke M., Sillard R., Pardigol A., Uguccioni M., Baggiolini M., Forssmann W.-G.J. Exp. Med. 183:295-299 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Neurofilament light polypeptide (NEFL)
MBS963565-01 0.02 mg (E-Coli)

Recombinant Human Neurofilament light polypeptide (NEFL)

Ask
View Details
Recombinant Human Neurofilament light polypeptide (NEFL)
MBS963565-02 0.1 mg (E-Coli)

Recombinant Human Neurofilament light polypeptide (NEFL)

Ask
View Details
Recombinant Human Neurofilament light polypeptide (NEFL)
MBS963565-03 1 mg (E-Coli)

Recombinant Human Neurofilament light polypeptide (NEFL)

Ask
View Details
TSC22D3 (NM_001015881) Human Tagged ORF Clone Lentiviral Particle
RC214246L4V 200 µL

TSC22D3 (NM_001015881) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
OtµLinl Rat shRNA Lentiviral Particle (Locus ID 310190)
TL703531V 500 µL Each

OtµLinl Rat shRNA Lentiviral Particle (Locus ID 310190)

Ask
View Details
Tmem22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47008114 3x 1.0 µg

Tmem22 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details