Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Versican core protein (VCAN), partial

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan core protein 2

Abbreviation

Recombinant Human VCAN protein, partial

Gene Name

VCAN

UniProt

P13611

Expression Region

3089-3354aa

Organism

Homo sapiens (Human)

Target Sequence

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Molecular Weight

47.6 kDa

References & Citations

"A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican." Dours-Zimmermann M.T., Zimmermann D.R. J. Biol. Chem. 269:32992-32998 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SIRT6 Antibody [DyLight 650]
NB100-2523C 0.1 mL

Rabbit Polyclonal SIRT6 Antibody [DyLight 650]

Sign In for Pricing
View Details
DAZAP2 (KIAA0058, DAZ-associated Protein 2, Deleted in Azoospermia-associated Protein 2, MGC14319, MGC766)
125643 100 µg

DAZAP2 (KIAA0058, DAZ-associated Protein 2, Deleted in Azoospermia-associated Protein 2, MGC14319, MGC766)

Sign In for Pricing
View Details
2-Hydroxybenzimidazole
sc-209198 1 g

2-Hydroxybenzimidazole

Sign In for Pricing
View Details
TMEM90A sgRNA CRISPR Lentivector set (Human)
K2394801 3x 1.0 µg

TMEM90A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
LMAN1 Rabbit pAb (APR18063N)
APR18063N-01 50 µL

LMAN1 Rabbit pAb (APR18063N)

Sign In for Pricing
View Details
LMAN1 Rabbit pAb (APR18063N)
APR18063N-02 100 µL

LMAN1 Rabbit pAb (APR18063N)

Sign In for Pricing
View Details