Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin 17A (IL17A)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rhesus macaque IL17A protein

Gene Name

IL17A

UniProt

F6T3G5

Expression Region

24-155aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.1 kDa

References & Citations

Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques.Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. , Wang J., Zhuo M., Wang T., Huang Y., Wei L., Li J., Wang Z., Hu H., Yang P., Le L., Stenson P.D., Li B., Liu X., Ball E.V., An N., Huang Q., Zhang Y., Fan W., Zhang X., Li Y., Wang W., Katze M.G., Su B., Nielsen R., Yang H., Wang J., Wang X., Wang J.Nat. Biotechnol. 29:1019-1023 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS2 (NM_001037967) Human Over-expression Lysate
LY421996 100 µg

ALAS2 (NM_001037967) Human Over-expression Lysate

Sign In for Pricing
View Details
Melanopsin (OPN4) (NM_001030015) Human Over-expression Lysate
LY422235 100 µg

Melanopsin (OPN4) (NM_001030015) Human Over-expression Lysate

Sign In for Pricing
View Details
(3-Nitrophenyl)hydrazine (13C6) Hydrochloride
TRC-N420521-10MG 10 mg

(3-Nitrophenyl)hydrazine (13C6) Hydrochloride

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2788), CF405S conjugate, 0.1mg/mL
BNC042788-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2788), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEK1 (MAP2K1) pThr292 Rabbit Polyclonal Antibody
AP20802PU-N 100 µg

MEK1 (MAP2K1) pThr292 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RC) Mouse Monoclonal Antibody [Clone ID: MT2]
AM39022FC-N 100 Tests

CD45 (PTPRC) (CD45RC) Mouse Monoclonal Antibody [Clone ID: MT2]

Sign In for Pricing
View Details