Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone sialoprotein 2 (IBSP), partial

Product Specifications

Product Name Alternative

Bone sialoprotein II

Abbreviation

Recombinant Human IBSP protein, partial

Gene Name

IBSP

UniProt

P21815

Expression Region

129-281aa

Organism

Homo sapiens (Human)

Target Sequence

AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Molecular Weight

32.4 kDa

References & Citations

"Human bone sialoprotein. Deduced protein sequence and chromosomal localization." Fisher L.W., McBride O.W., Termine J.D., Young M.F. J. Biol. Chem. 265:2347-2351 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb19 (NM_145157) Mouse Untagged Clone
MC205122 10 µg

Defb19 (NM_145157) Mouse Untagged Clone

Sign In for Pricing
View Details
SLC27A5 3'UTR Lenti-reporter-Luc Vector
44079081 1.0 µg

SLC27A5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Porcine Inhibin A (INHA) ELISA Kit
NSL0453Po 96 Tests

Porcine Inhibin A (INHA) ELISA Kit

Sign In for Pricing
View Details
Recombinant human TSLP (R127A, R130A) Protein, C-His-Avi (HEK293), Biotin Conjugated
bs-47223P-Biotin-01 50 µg

Recombinant human TSLP (R127A, R130A) Protein, C-His-Avi (HEK293), Biotin Conjugated

Sign In for Pricing
View Details
Recombinant human TSLP (R127A, R130A) Protein, C-His-Avi (HEK293), Biotin Conjugated
bs-47223P-Biotin-02 500 µg

Recombinant human TSLP (R127A, R130A) Protein, C-His-Avi (HEK293), Biotin Conjugated

Sign In for Pricing
View Details
LILRB3 Antibody BIOTIN-Conjugated
MBS541998-01 0.1 mg

LILRB3 Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details