Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Somatotropin (GH1)

Product Specifications

Product Name Alternative

Growth hormone

Abbreviation

Recombinant Pig GH1 protein

Gene Name

GH1

UniProt

P01248

Expression Region

1-216aa

Organism

Sus scrofa (Pig)

Target Sequence

MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Molecular Weight

29.4 kDa

References & Citations

"Porcine growth hormone: molecular cloning of cDNA and expression in bacterial and mammalian cells." Kato Y., Shimokawa N., Kato T., Hirai T., Yoshihama K., Kawai H., Hattori M.A., Ezashi T., Shimogori Y., Wakabayashi K. Biochim. Biophys. Acta 1048:290-293 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA3E (NM_207312) Human Over-expression Lysate
LC404091 20 µg

TUBA3E (NM_207312) Human Over-expression Lysate

Sign In for Pricing
View Details
EDA2R Antibody (Biotin)
KB-2592-01 50 μL

EDA2R Antibody (Biotin)

Sign In for Pricing
View Details
EDA2R Antibody (Biotin)
KB-2592-02 100 µL

EDA2R Antibody (Biotin)

Sign In for Pricing
View Details
EDA2R Antibody (Biotin)
KB-2592-03 1 mL

EDA2R Antibody (Biotin)

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), Biotin conjugate, 0.1mg/mL
BNCB0021-100 1x 100 µL

Cytokeratin 18 (DC10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SNAI3 protein (His tag)
PDEH100982-01 20 µg

Recombinant Human SNAI3 protein (His tag)

Sign In for Pricing
View Details