Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Desmoglein-3 (DSG3), partial

Product Specifications

Product Name Alternative

130KDA pemphigus vulgaris antigen ; PVACadherin family member 6

Abbreviation

Recombinant Human DSG3 protein, partial

Gene Name

DSG3

UniProt

P32926

Expression Region

70-499aa

Organism

Homo sapiens (Human)

Target Sequence

IAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVISRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAASNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGTVYVRVPDFNDNCPTAVLEK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Adhesion

Relevance

Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.

Molecular Weight

64 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF18 (NM_001184723) Human Over-expression Lysate
LY432679 100 µg

TM4SF18 (NM_001184723) Human Over-expression Lysate

Sign In for Pricing
View Details
MYL2 Polyclonal Antibody
E-AB-70328-01 60 µL

MYL2 Polyclonal Antibody

Sign In for Pricing
View Details
MYL2 Polyclonal Antibody
E-AB-70328-02 120 µL

MYL2 Polyclonal Antibody

Sign In for Pricing
View Details
MYL2 Polyclonal Antibody
E-AB-70328-03 200 µL

MYL2 Polyclonal Antibody

Sign In for Pricing
View Details
Claudin18 Rabbit Polyclonal Antibody
HA500131 100 µL

Claudin18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
METTL3 Antibody
KC-47503-01 50 μL

METTL3 Antibody

Sign In for Pricing
View Details