Recombinant Human Lymphocyte antigen 96 (LY96) (R56G)
Product Specifications
Product Name Alternative
ESOP-1 (Protein MD-2) (ESOP1) (MD2)
Abbreviation
Recombinant Human LY96 protein (R56G)
Gene Name
LY96
UniProt
Q9Y6Y9
Expression Region
19-160aa (R56G)
Organism
Homo sapiens (Human)
Target Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Tag
N-terminal 10xHis-tagged
Type
Developed Protein
Source
Baculovirus
Field of Research
Immunology
Relevance
Binds bacterial lipopolysaccharide . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide , and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria . Enhances TLR4-dependent activation of NF-kappa-B . Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS .
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
17.5 kDa
References & Citations
"Natural selection in the TLR-related genes in the course of primate evolution." Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735 (2008)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681012-500 1x 500 µL
S100B (S100B/1012), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040812-500 1x 500 µL
Tyrosinase (OCA1/812), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402130-500 1x 500 µL
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880204-500 1x 500 µL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details