Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vesicular glutamate transporter 2 (Slc17a6), partial

Product Specifications

Product Name Alternative

(VGluT2) (Differentiation-associated BNPI) (Differentiation-associated Na (+) (Solute carrier family 17 member 6)

Abbreviation

Recombinant Rat Slc17a6 protein, partial

Gene Name

Slc17a6

UniProt

Q9JI12

Expression Region

499-582aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate. At the synaptic vesicle membrane, mainly functions as a uniporter which transports preferentially L-glutamate but also, phosphate from the cytoplasm into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. The L-glutamate or phosphate uniporter activity is electrogenic and is driven by the proton electrochemical gradient, mainly by the electrical gradient established by the vacuolar H (+) -ATPase across the synaptic vesicle membrane. In addition, functions as a chloride channel that allows a chloride permeation through the synaptic vesicle membrane therefore affects the proton electrochemical gradient and promotes synaptic vesicles acidification. Moreover, functions as a vesicular K (+) /H (+) antiport allowing to maintain the electrical gradient and to decrease chemical gradient and therefore sustain vesicular L-glutamate uptake. The vesicular H (+) /H (+) antiport activity is electroneutral. At the plasma membrane, following exocytosis, functions as a symporter of Na (+) and phosphate from the extracellular space to the cytoplasm allowing synaptic phosphate homeostasis regulation. The symporter activity is driven by an inside negative membrane potential and is electrogenic. Also involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine L-glutamatergic system of other tissues such as pineal gland and pancreas.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.1 kDa

References & Citations

"Differentiation-associated Na+-dependent inorganic phosphate cotransporter (DNPI) is a vesicular glutamate transporter in endocrine glutamatergic systems." Hayashi M., Otsuka M., Morimoto R., Hirota S., Yatsushiro S., Takeda J., Yamamoto A., Moriyama Y. J. Biol. Chem. 276:43400-43406 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Oryza sativa subsp. japonica (Rice) IMCE Polyclonal Antibody
MBS7197901 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) IMCE Polyclonal Antibody

Ask
View Details
Fas Antibody (YA446, Rabbit)
HY-P80126-01 10 µL

Fas Antibody (YA446, Rabbit)

Ask
View Details
Fas Antibody (YA446, Rabbit)
HY-P80126-02 50 μL

Fas Antibody (YA446, Rabbit)

Ask
View Details
Fas Antibody (YA446, Rabbit)
HY-P80126-03 100 µL

Fas Antibody (YA446, Rabbit)

Ask
View Details
Histone Cluster 2, H2ac (Biotin)
547550 200 µL

Histone Cluster 2, H2ac (Biotin)

Ask
View Details