Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDC/GREM2, Mouse

PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PRDC/GREM2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdc-grem2-protein-mouse.html

Purity

96.00

Smiles

RKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ

Molecular Formula

23893 (Gene_ID) O88273/NP_035955 (R22-Q168) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GL45 Lab Bottle Screw Cap - Lip Seal PP Grey
29338288 10 / PCK

GL45 Lab Bottle Screw Cap - Lip Seal PP Grey

Sign In for Pricing
View Details
EDG1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1) (PE)
126157-PE 100 µL

EDG1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1) (PE)

Sign In for Pricing
View Details
Anti-Phospho-SHP-1 (Tyr564) Polyclonal Antibody 2
TMAC-03744-01 50 μL

Anti-Phospho-SHP-1 (Tyr564) Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-Phospho-SHP-1 (Tyr564) Polyclonal Antibody 2
TMAC-03744-02 100 µL

Anti-Phospho-SHP-1 (Tyr564) Polyclonal Antibody 2

Sign In for Pricing
View Details
Recombinant Human PIM1, N-His
MBS1573302-01 0.1 mg

Recombinant Human PIM1, N-His

Sign In for Pricing
View Details
Recombinant Human PIM1, N-His
MBS1573302-02 1 mg

Recombinant Human PIM1, N-His

Sign In for Pricing
View Details