Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDC/GREM2, Mouse

PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PRDC/GREM2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdc-grem2-protein-mouse.html

Purity

96.00

Smiles

RKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ

Molecular Formula

23893 (Gene_ID) O88273/NP_035955 (R22-Q168) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Fibroblast growth factor 16 ELISA kit
GTR10386547 96 Well

Goat Fibroblast growth factor 16 ELISA kit

Sign In for Pricing
View Details
FA5 (heavy chain, Cleaved-Ala29) rabbit pAb
ES19967-01 50 µL

FA5 (heavy chain, Cleaved-Ala29) rabbit pAb

Sign In for Pricing
View Details
FA5 (heavy chain, Cleaved-Ala29) rabbit pAb
ES19967-02 100 µL

FA5 (heavy chain, Cleaved-Ala29) rabbit pAb

Sign In for Pricing
View Details
FBXO33 3'UTR Lenti-reporter-Luc Vector
20327081 1.0 µg

FBXO33 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SLC4A8 ORF Vector (Human) (pORF)
ORF009741 1.0 µg DNA

SLC4A8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
EDN2, CT (EDN2, Endothelin-2, Preproendothelin-2) (MaxLight 405)
MBS6294406-01 0.1 mL

EDN2, CT (EDN2, Endothelin-2, Preproendothelin-2) (MaxLight 405)

Sign In for Pricing
View Details